Pla2g10 (BC028879) Mouse Recombinant Protein
CAT#: TP500952
Purified recombinant protein of Mouse phospholipase A2, group X (cDNA clone MGC:25894 IMAGE:4218273), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200952 protein sequence
Red=Cloning site Green=Tags(s) MLLLLLLLLLGPGPGFSEATRRSHVYKRGLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWC CYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGECPMPCDFPKCPLDILQIPMAPVPLWTSREQMPRT FVQV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 26565 |
UniProt ID | Q9QXX3 |
Refseq Size | 1011 |
Cytogenetics | 16 9.5 cM |
Refseq ORF | 432 |
Synonyms | PLA2GX, mGXsPLA2, sPLA2-X |
Summary | This gene encodes a member of the phospholipase A2 family of lipolytic enzymes that hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids. The encoded protein undergoes proteolytic processing to generate a calcium-dependent enzyme that plays pivotal roles in the liberation of arachidonic acid from membrane phospholipids leading to the production of various inflammatory lipid mediators, such as prostaglandins. In response to myocardial ischemia/reperfusion, mice lacking the encoded protein display a reduction in myocardial infarct size partly through the suppression of neutorphil cytotoxic activities. Alternative splicing results in multiple transcript variants encoding different isoforms. All of these isoforms may undergo similar processing to generate the mature protein. [provided by RefSeq, Jul 2015] |
Documents
FAQs |
SDS |
其它Pla2g10产品