Sap18 (NM_009119) Mouse Recombinant Protein

CAT#: TP501109

Purified recombinant protein of Mouse Sin3-associated polypeptide 18 (Sap18), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201109 protein sequence
Red=Cloning site Green=Tags(s)

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT
SLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP
NRAPPSSGRMRPY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 17.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033145
Locus ID 20220
UniProt ID O55128
Refseq Size 3472
Cytogenetics 14 30.51 cM
Refseq ORF 459
Synonyms C530046K05Rik; D11Ertd539e; EMegR4; Sap18a; Sinbp1
Summary Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Component of the ASAP and PSAP complexes which bind RNA in a sequence-independent manner and are proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. The ASAP complex can inhibit mRNA processing during in vitro splicing reactions. The ASAP complex promotes apoptosis and is disassembled after induction of apoptosis. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits the formation of proapoptotic isoforms such as Bcl-X(S); the activity is different from the established EJC assembly and function (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...