Gadd45a (NM_007836) Mouse Recombinant Protein
CAT#: TP501332
Purified recombinant protein of Mouse growth arrest and DNA-damage-inducible 45 alpha (Gadd45a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201332 protein sequence
Red=Cloning site Green=Tags(s) MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA LQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTPDLHCVLVTNPHSSQWKDPAL SQLICFCRESRYMDQWVPVINLPER myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 18.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_031862 |
| Locus ID | 13197 |
| UniProt ID | P48316 |
| Refseq Size | 1224 |
| Cytogenetics | 6 C1 |
| Refseq ORF | 495 |
| Synonyms | AA545191; Ddit1; GADD45 |
| Summary | Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Gadd45a产品
