Gadd45a (NM_007836) Mouse Recombinant Protein
CAT#: TP501332
Purified recombinant protein of Mouse growth arrest and DNA-damage-inducible 45 alpha (Gadd45a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201332 protein sequence
Red=Cloning site Green=Tags(s) MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA LQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTPDLHCVLVTNPHSSQWKDPAL SQLICFCRESRYMDQWVPVINLPER myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 18.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031862 |
Locus ID | 13197 |
UniProt ID | P48316 |
Refseq Size | 1224 |
Cytogenetics | 6 C1 |
Refseq ORF | 495 |
Synonyms | AA545191; Ddit1; GADD45 |
Summary | Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Gadd45a产品