Ppp1r1a (NM_021391) Mouse Recombinant Protein
CAT#: TP501432
Purified recombinant protein of Mouse protein phosphatase 1, regulatory inhibitor subunit 1A (Ppp1r1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201432 protein sequence
Red=Cloning site Green=Tags(s) MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNSLLKSTLSMSPRQ RKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDTGSASRPDTPGTAQKSAESN PKTQEQCGVEPRTEDSSAHMLPLDSQGASLV myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 18.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_067366 |
| Locus ID | 58200 |
| UniProt ID | Q9ERT9 |
| Refseq Size | 1295 |
| Cytogenetics | 15 F3 |
| Refseq ORF | 513 |
| Synonyms | 0610038N18Rik; I-1 |
| Summary | Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Ppp1r1a产品
