Nenf (NM_025424) Mouse Recombinant Protein

CAT#: TP501443

Purified recombinant protein of Mouse neuron derived neurotrophic factor (Nenf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201443 representing NM_025424
Red=Cloning site Green=Tags(s)

MARPAPWWRLRLLAALVLALALVPVPSAWAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGV
VFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDTTGLTAKELEALDDVFSKVYKAKYPIVG
YTARRILNEDGSPNLDFKPEDQPHFDIKDEF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 19.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079700
Locus ID 66208
UniProt ID Q9CQ45
Refseq Size 658
Cytogenetics 1 H6
Refseq ORF 513
Synonyms 1110060M21Rik; SCIRP10; Spuf
Summary Acts as a neurotrophic factor in postnatal mature neurons, enhancing neuronal survival (PubMed:15605373). Promotes cell proliferation and neurogenesis in undifferentiated neural pro-genitor cells at the embryonic stage and inhibits differentiation of astrocyte (PubMed:16547973). Its neurotrophic activity is exerted via MAPK1/ERK2, MAPK3/ERK1 and AKT1/AKT pathways (PubMed:15605373, PubMed:16547973). Neurotrophic activity is enhanced by binding to heme (PubMed:18056703). Acts also as an anorexigenic neurotrophic factor that contributes to energy balance (PubMed:23576617).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...