Map2k3 (BC007467) Mouse Recombinant Protein
CAT#: TP501496
Purified recombinant protein of Mouse mitogen activated protein kinase kinase 3 (cDNA clone MGC:5915 IMAGE:3497714), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201496 protein sequence
Red=Cloning site Green=Tags(s) MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL GRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICM ELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSM myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 19.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 26397 |
| UniProt ID | O09110 |
| Refseq Size | 2096 |
| Cytogenetics | 11 B2 |
| Refseq ORF | 519 |
| Synonyms | MEK3, MKK3, mMKK3b |
| Summary | Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
