Adcyap1 (NM_009625) Mouse Recombinant Protein
CAT#: TP501524
Purified recombinant protein of Mouse adenylate cyclase activating polypeptide 1 (Adcyap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR201524 protein sequence 
Red=Cloning site Green=Tags(s) MTMCSGARLALLVYGIIMHSSVSCSPAAGLSFPGIRPEDEAYDQDGNPLQDFYDWDPPGVGSPASALRDA YALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSVVARGAGENLGGSAVDDPAPLTKRHSDGIFTDSY SRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 19.4 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_033755 | 
| Locus ID | 11516 | 
| UniProt ID | O70176 | 
| Refseq Size | 2108 | 
| Cytogenetics | 17 E5 | 
| Refseq ORF | 525 | 
| Synonyms | P; PACAP | 
| Summary | This gene encodes a member of the glucagon superfamily of hormones that have important roles in growth and metabolism. The encoded protein undergoes proteolytic processing to generate mature peptides that function as hypophysiotropic hormones, neurotransmitters, neuromodulators and vasoregulators. Mice lacking the encoded protein exhibit a high rate of early mortality. The surviving adult animals lacking the encoded protein exhibit decreased anxiety, hyperactive behavior and impaired steroidogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2015] | 
Documents
| FAQs | 
| SDS | 
其它Adcyap1产品
