Sip1 (BC053424) Mouse Recombinant Protein
CAT#: TP501583
Purified recombinant protein of Mouse survivor of motor neuron protein interacting protein 1 (cDNA clone MGC:59266 IMAGE:6336522), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201583 protein sequence
Red=Cloning site Green=Tags(s) MYVLLNCRIEAAQCPDVVVAQIDPKKLKRKQSVNISVQRFSPLSSRWEHGSIQAGLAQEELRVLHLHPKA ASGRLTPRQLGFPDASLRLKVTLQHFSGNNNKWHIFQLFDRVYTSIEITGNHNSWTVMWQCQNLKMKKAG KNFVWVKGYVLKGPLDRLQRKALGSIMYKLVFLLCLVL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 66603 |
UniProt ID | Q9CQQ4 |
Refseq Size | 2064 |
Cytogenetics | 12 C1 |
Refseq ORF | 534 |
Synonyms | Gemin2 |
Summary | This gene encodes one of the proteins found in the survival of motor neuron (SMN) complex, which consists of the SMN protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal small nuclear ribonucleoproteins (snRNP) and for pre-mRNA splicing. This protein interacts directly with the SMN protein and it is required for formation of the SMN complex. Disruption of this gene in mouse resulted in impaired snRNP assembly, and motor neuron degeneration. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
SDS |