D2Wsu81e (BC078441) Mouse Recombinant Protein
CAT#: TP501597
Purified recombinant protein of Mouse DNA segment, Chr 2, Wayne State University 81, expressed (cDNA clone MGC:90552 IMAGE:5686308), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201597 protein sequence
Red=Cloning site Green=Tags(s) MKKLERQRAQEEEAKRQEEEEEAAAQRSNQGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACTIFCV DEIVVFDEEGQDTKSVEGEFRGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGILNPLDSPH HMRQDEESEFREGVVVDRPTKAGHGSLVNCGMKKLLFRR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 227695 |
UniProt ID | Q3UHX9 |
Refseq Size | 2440 |
Cytogenetics | 2 21.29 cM |
Refseq ORF | 537 |
Synonyms | 9930028P05; AL033358 |
Summary | Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. Also involved in chromosome alignment. May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis. Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它D2Wsu81e产品