Rap2b (NM_028712) Mouse Recombinant Protein
CAT#: TP501667
Purified recombinant protein of Mouse RAP2B, member of RAS oncogene family (Rap2b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201667 protein sequence
Red=Cloning site Green=Tags(s) MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082988 |
Locus ID | 74012 |
UniProt ID | P61226, Q6ZWR0 |
Refseq Size | 4197 |
Cytogenetics | 3 E1 |
Refseq ORF | 552 |
Synonyms | 4021402C18Rik; AA408554 |
Summary | Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |