Ppp1r1b (NM_144828) Mouse Recombinant Protein
CAT#: TP501884
Purified recombinant protein of Mouse protein phosphatase 1, regulatory inhibitor subunit 1B (Ppp1r1b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201884 protein sequence
Red=Cloning site Green=Tags(s) MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRVSEHSSPEEEASPHQRTSGEGHHPKSKRPN PCAYTPPSLKAVQHLQTISNLSENQASEEEDELGELRELGYPQEDDEEDEDEEEDEEEDSQAEVLKGSRG TVGQKPTCGRGLEGPWERPPPLDEPQRDGNSEDQVEGRATLSEPGEEPQHPSPP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659077 |
Locus ID | 19049 |
UniProt ID | Q60829 |
Refseq Size | 1682 |
Cytogenetics | 11 D |
Refseq ORF | 582 |
Synonyms | AU040756; Dar; DARP; DARPP-32; Darpp32 |
Summary | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders in humans. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
SDS |
其它Ppp1r1b产品