Hikeshi (NM_026304) Mouse Recombinant Protein
CAT#: TP501959
Purified recombinant protein of Mouse heat shock protein nuclear import factor (Hikeshi), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201959 protein sequence
Red=Cloning site Green=Tags(s) MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGVPVWQLL GFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQ FTQKMLDNFYNFASSFALSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWKT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080580 |
Locus ID | 67669 |
UniProt ID | Q9DD02 |
Refseq Size | 1085 |
Cytogenetics | 7 50.4 cM |
Refseq ORF | 591 |
Synonyms | 0610007P06Rik; 1110002N09Rik; l(7)6Rn; l7Rn6 |
Summary | Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus (By similarity). May also be indirectly required for organization and/or function of the secretory apparatus in Clara cells in lung.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Hikeshi产品