Arl6ip1 (NM_019419) Mouse Recombinant Protein
CAT#: TP502096
Purified recombinant protein of Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202096 protein sequence
Red=Cloning site Green=Tags(s) MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIYYLDPSVLSGV SCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFSLKEEKPKMYFMT MIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 23.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_062292 |
| Locus ID | 54208 |
| UniProt ID | Q9JKW0 |
| Refseq Size | 2154 |
| Cytogenetics | 7 F1 |
| Refseq ORF | 609 |
| Synonyms | Aip-1; AIP-6; AL022945; Arl6ip; ARMER; AU042858; C85138; mKIAA0069 |
| Summary | Positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. Promotes the catalytic efficiency of SLC1A1/EAAC1 probably by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport (PubMed:18684713). Plays a role in the formation and stabilization of endoplasmic reticulum tubules. Negatively regulates apoptosis, possibly by modulating the activity of caspase-9 (CASP9). Inhibits cleavage of CASP9-dependent substrates and downstream markers of apoptosis but not CASP9 itself. May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Arl6ip1产品
