Arl6ip1 (NM_019419) Mouse Recombinant Protein

CAT#: TP502096

Purified recombinant protein of Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202096 protein sequence
Red=Cloning site Green=Tags(s)

MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIYYLDPSVLSGV
SCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFSLKEEKPKMYFMT
MIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062292
Locus ID 54208
UniProt ID Q9JKW0
Refseq Size 2154
Cytogenetics 7 F1
Refseq ORF 609
Synonyms Aip-1; AIP-6; AL022945; Arl6ip; ARMER; AU042858; C85138; mKIAA0069
Summary Positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. Promotes the catalytic efficiency of SLC1A1/EAAC1 probably by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport (PubMed:18684713). Plays a role in the formation and stabilization of endoplasmic reticulum tubules. Negatively regulates apoptosis, possibly by modulating the activity of caspase-9 (CASP9). Inhibits cleavage of CASP9-dependent substrates and downstream markers of apoptosis but not CASP9 itself. May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...