Spata24 (NM_029485) Mouse Recombinant Protein
CAT#: TP502158
Purified recombinant protein of Mouse spermatogenesis associated 24 (Spata24), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202158 representing NM_029485
Red=Cloning site Green=Tags(s) MATPLGWSQGGSGSVCLAFDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFHEIEKKLVEEKAAHAKT KALLAKEEEKLQFALGEVEVLSKQLEKEKMAFEKALSSVKSRVLQESSKKDQLITKCNEIESHIIKQEDI LNGKENEIKELQQVISQQKQNFRNHISDFRIQKQQETYMAQVLDQKRKKATGMRRARSRQCSREK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 23.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083761 |
Locus ID | 71242 |
UniProt ID | Q6P926 |
Refseq Size | 721 |
Cytogenetics | 18 B2 |
Refseq ORF | 615 |
Synonyms | 2700012K08Rik; 4930583E11Rik; 5133400G04Rik; AU016220; TIPT; TIPT2 |
Summary | Binds DNA with high affinity but does not bind to TATA boxes. Synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter. May play a role in cytoplasm movement and removal during spermiogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Spata24产品