Tspan15 (BC003872) Mouse Recombinant Protein
CAT#: TP502186
Purified recombinant protein of Mouse tetraspanin 15 (cDNA clone MGC:6632 IMAGE:3492667), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202186 protein sequence
Red=Cloning site Green=Tags(s) MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESAFLAPAIILILLG VVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQTIDFLNDNIRRGIENYYDDLD FKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTMLSTPCVATKQSTRSA myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 23.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 70423 |
| UniProt ID | F7BWT7 |
| Refseq Size | 1661 |
| Cytogenetics | 10 B4 |
| Refseq ORF | 618 |
| Synonyms | 1110036D12Rik; 2700063A19Rik; AW048364; Tm4sf15 |
| Summary | Regulates maturation and trafficking of the transmembrane metalloprotease ADAM10 (PubMed:23035126, PubMed:26668317). Promotes ADAM10-mediated cleavage of (CDH2) (PubMed:26668317). Negatively regulates ligand-induced Notch activity probably by regulating ADAM10 activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Tspan15产品
