Wdyhv1 (NM_029734) Mouse Recombinant Protein

CAT#: TP502245

Purified recombinant protein of Mouse WDYHV motif containing 1 (Wdyhv1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202245 protein sequence
Red=Cloning site Green=Tags(s)

MEGDGPAATAPQYQPVCPTRDACVYNSCYCEENIWKLCEYIKTHNQYLLEECYAVFISNEKKMVPIWKQQ
ARPENGPVIWDYHVVLLHVSREGQSFIYDLDTILPFPCPFDIYIEDALKSDDDIHLQFRRKFRVVRADSY
LKHFASDRSHMKDSSGNWREPPPEYPCIETGDSKMNLNDFISMDPAVGWGAVYTLPEFVHRFSSKTYQA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_084010
Locus ID 76773
UniProt ID Q80WB5
Refseq Size 1354
Cytogenetics 15
Refseq ORF 627
Synonyms 2410187C16Rik; AU014961; AW550036; Ntaq1
Summary Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. Does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position. Does not deaminate acetylated N-terminal glutamine. With the exception of proline, all tested second-position residues on substrate peptides do not greatly influence the activity. In contrast, a proline at position 2, virtually abolishes deamidation of N-terminal glutamine.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...