Zfyve21 (NM_026752) Mouse Recombinant Protein
CAT#: TP502323
Purified recombinant protein of Mouse zinc finger, FYVE domain containing 21 (Zfyve21), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202323 protein sequence
Red=Cloning site Green=Tags(s) MVPEHRAFGSPFGLEEPQWVPDKECPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDP VRQCADCALVSHREAEFYDKQLKVLLSGATFLVTFGDSEKPETMVCRLSNNQRCLVLDGDSHREIEIAHV CTVQILTEGFTPGAGSTRATGMLLQYTVPGAEAAAQLRLMAGEDASGSKRQAAAWLAAMHKATKLLYESR DQ myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 23.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_081028 |
| Locus ID | 68520 |
| UniProt ID | Q8VCM3 |
| Refseq Size | 1310 |
| Cytogenetics | 12 F1 |
| Refseq ORF | 636 |
| Synonyms | 1110013H04Rik; AW558780; C85416 |
| Summary | Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Zfyve21产品
