Rassf4 (BC023245) Mouse Recombinant Protein
CAT#: TP502397
Purified recombinant protein of Mouse Ras association (RalGDS/AF-6) domain family 4 (cDNA clone MGC:27537 IMAGE:4459337), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR202397 protein sequence 
Red=Cloning site Green=Tags(s) MKEACSSSSHVPVSDSKYILKSELLSLLKTYNCYHEGRSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQ MQDDRERVHLPSATWVPERLSYLQKEASPQDSKVPTEEPGTQPANKAEVSGDSSGALEGEEEEVPQLMRT KSDASCIIQRRSKSRAPSEAQKIRRHRFSINGHFYNHKVKSPSALSWALKLRVQELFPSTEERAPNIQHS SHSSIR myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 24.6 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| Locus ID | 213391 | 
| UniProt ID | Q8CB96 | 
| Refseq Size | 2817 | 
| Cytogenetics | 6 E3 | 
| Refseq ORF | 648 | 
| Synonyms | 3830411C14Rik; AD037; AI586137 | 
| Summary | Potential tumor suppressor. May act as a KRAS effector protein. May promote apoptosis and cell cycle arrest.[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
