Creg1 (NM_011804) Mouse Recombinant Protein

CAT#: TP502502

Purified recombinant protein of Mouse cellular repressor of E1A-stimulated genes 1 (Creg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Cited in 1 publication.

Product images

推荐一起购买 (2)
Creg1 Antibody - C-terminal region
    • 50 ug

CNY 4628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202502 protein sequence
Red=Cloning site Green=Tags(s)

MAARAPELARSLLAALLAPALVALLVSPASGRGGRDHGDWDVDRRLPPLPPREDGPRVARFVTHVSDWGS
LATISTIKEVRGWPFADIISISDGPPGEGTGEPYMYLSPLQQAVSDLQENPEATLTMSLAQTVYCRNHGF
DPQSPLCVHIMMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVLDYFGGPKVVT
PEEYFNVTLQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035934
Locus ID 433375
UniProt ID O88668
Refseq Size 2138
Cytogenetics 1 H2.3
Refseq ORF 660
Synonyms AA755314; Creg
Summary May contribute to the transcriptional control of cell growth and differentiation. Antagonizes transcriptional activation and cellular transformation by the adenovirus E1A protein. The transcriptional control activity of cell growth requires interaction with IGF2R (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Documents

Customer Reviews 
Loading...