Gadd45gip1 (NM_183358) Mouse Recombinant Protein
CAT#: TP502550
Purified recombinant protein of Mouse growth arrest and DNA-damage-inducible, gamma interacting protein 1 (Gadd45gip1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202550 representing NM_183358
Red=Cloning site Green=Tags(s) MAALAMRSGYLLRLSVALGPRSRSYRAPPPPRRRPGPHSPDPENLLTPRWQLTPRYVAKQFGRHGAISGV PPASLWPTPEQLRELEAEEQEWYPSLATMQESLRLQQQALEARRQAREQRIAECMAKMPQMIENWRKQKR ERWEKIQADKERRARLQAEAQERLGYHVDPRSARFQELLQDLDKQQRKRLKEERQRQKKEARIAAMASAE AQDSAVSGEPSS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899202 |
Locus ID | 102060 |
UniProt ID | Q9CR59 |
Refseq Size | 1734 |
Cytogenetics | 8 C3 |
Refseq ORF | 666 |
Synonyms | 2310040G17Rik; AI425883; Crif1; MRP-L59; Plinp1 |
Summary | Acts as a negative regulator of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occurs also in the absence of GADD45 proteins. Acts as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity. May be involved in the hormone-mediated regulation of NR4A1 transcriptional activity. May play a role in mitochondrial protein synthesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Gadd45gip1产品