Trmt11 (BC048703) Mouse Recombinant Protein
CAT#: TP502863
Purified recombinant protein of Mouse tRNA methyltransferase 11 homolog (S. cerevisiae) (cDNA clone MGC:59417 IMAGE:6509593), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202863 protein sequence
Red=Cloning site Green=Tags(s) MGGLLIASAHFGAYVCGTDIDYNTVHGLGKASRKNQKWRGPDENIRANLRQYGLEKFYLDVLVSDASKPS WRKGTYFDAIITDPPYGIRESTRRSGSQKDIPKGIEKCPESHVPVSLSYHLSDMFFDLLNFAAETLVLGG RLVYWLPVYTPEYTEEMVPWHPCLRLISNCEQKLSSHTARRLITMEKVKEFENRDKYSHLLSDHFLPYQG HNSFREKYFSGVTKRIAKEEKCSHE myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 27.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 73681 |
| Refseq Size | 1574 |
| Cytogenetics | 10 A4 |
| Refseq ORF | 705 |
| Synonyms | 2410075D05Rik; 3110045I18Rik; AW213713 |
| Summary | Catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
