Nudt18 (BC036718) Mouse Recombinant Protein
CAT#: TP503089
Purified recombinant protein of Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 18 (cDNA clone MGC:38179 IMAGE:5322150), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR203089 protein sequence
Red=Cloning site Green=Tags(s) MEPGETIVEAMQREVKEEAGLLCEPVTLLSVEERGASWIRFVFLARPTGGVLKTSKDADSESLQAGWYPR VSLPTPLRAHDVLHLVELGAKFCQQAMHPLILPQELPCSVVCQRLVTTFTTVQSVWVLVGTVGTPHLPIT ACGFTPMEQRGGIKVAILRLLQECLTLHSLAVETKGLLGLQHLGRDHVDGVCLNVLVTVAFRNPGIQDEP PKIRGENYFWWKVLEEDLQKLLLYRLQESSVIPLSR myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 27.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 213484 |
| UniProt ID | Q3U2V3 |
| Refseq Size | 1630 |
| Cytogenetics | 14 D2 |
| Refseq ORF | 738 |
| Synonyms | MGC38179 |
| Summary | Mediates the hydrolyzis of oxidized nucleoside diphosphate derivatives. Hydrolyzes 8-oxo-7,8-dihydroguanine (8-oxo-Gua)-containing deoxyribo- and ribonucleoside diphosphates to the monophosphates. Hydrolyzes 8-oxo-dGDP and 8-oxo-GDP with the same efficiencies. Hydrolyzes also 8-OH-dADP and 2-OH-dADP. Exhibited no or minimal hydrolyzis activity against 8-oxo-dGTP, 8-oxo-GTP, dGTP, GTP, dGDP and GDP. Probably removes oxidized guanine nucleotides from both the DNA and RNA precursor pools (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
