Pagr1a (NM_030240) Mouse Recombinant Protein

CAT#: TP503226

Purified recombinant protein of Mouse PAXIP1 associated glutamate rich protein 1A (Pagr1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203226 protein sequence
Red=Cloning site Green=Tags(s)

MSLALGHGTIAGSTAAPLSEEGEVTSGLQALAVEDTGGPSVSASKAEEEGKGSQEEAGREGSRPEEALEA
PSAASDERAEGEAEDWCVPCSDEEVELPANGQSWMPPPSEIQRLYELLATQGTLELQAEILPRRPPTPEA
QSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPMTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRH
KKLEEQILRTGRDLFSLDSEGPSPTSPPLRSSGNSLFPRQRKY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_084516
Locus ID 67278
UniProt ID Q99L02
Refseq Size 1448
Cytogenetics 7 F3
Refseq ORF 759
Synonyms 2900092E17Rik; C77040; PA1; PAGR1
Summary Its association with the histone methyltransferase MLL2/MLL3 complex is suggesting a role in epigenetic transcriptional activation. However, in association with PAXIP1/PTIP is proposed to function at least in part independently of the MLL2/MLL3 complex. Proposed to be recruited by PAXIP1 to sites of DNA damage where the PAGR1:PAXIP1 complex is required for cell survival in response to DNA damage independently of the MLL2/MLL3 complex (PubMed:19124460). However, its function in DNA damage has been questioned (PubMed:26744420). During immunoglobulin class switching in activated B-cells is involved in transcription regulation of downstream switch regions at the immunoglobulin heavy-chain (Igh) locus independently of the MLL2/MLL3 complex (PubMed:26744420). Involved in both estrogen receptor-regulated gene transcription and estrogen-stimulated G1/S cell-cycle transition (By similarity). Acts as transcriptional cofactor for nuclear hormone receptors. Inhibits the induction properties of several steroid receptors such as NR3C1, AR and PPARG; the mechanism of inhibition appears to be gene-dependent (By similarity). May be involved in the regulation of the BMP pathway in extraembryonic development (PubMed:24633704).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...