Ube2q1 (BC082275) Mouse Recombinant Protein
CAT#: TP503239
Purified recombinant protein of Mouse ubiquitin-conjugating enzyme E2Q (putative) 1 (cDNA clone MGC:90946 IMAGE:6310111), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203239 protein sequence
Red=Cloning site Green=Tags(s) MLDQPLPAEQCTQEEVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQ DYLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEK EGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISATLVK GKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKEDG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 70093 |
UniProt ID | Q7TSS2 |
Refseq Size | 1686 |
Cytogenetics | 3 F1 |
Refseq ORF | 759 |
Synonyms | NICE-5, PRO3094, Ube2q |
Summary | Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Involved in female fertility and embryo implantation (PubMed:23108111). May be involved in hormonal homeostasis in females (PubMed:23108111). Involved in regulation of B4GALT1 cell surface expression, B4GALT1-mediated cell adhesion to laminin and embryoid body formation (PubMed:18511602).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |