Meox1 (NM_010791) Mouse Recombinant Protein
CAT#: TP503243
Purified recombinant protein of Mouse mesenchyme homeobox 1 (Meox1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR203243 protein sequence
Red=Cloning site Green=Tags(s) MDPVANSCVRNPQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSFHQKSDFPATAAYPDFSASCLAATPH SLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTAGLGEDCMVLGTIAN ETEKKSSRRKKERSDNQENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLS ERQVKVWFQNRRMKWKRVKGGQPVSPQEQDREDGDSAASPSSE myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 28 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_034921 |
| Locus ID | 17285 |
| UniProt ID | P32442 |
| Refseq Size | 2235 |
| Cytogenetics | 11 65.48 cM |
| Refseq ORF | 759 |
| Synonyms | AI385561; D330041M02Rik; Mox-1; Mox1 |
| Summary | Mesodermal transcription factor that plays a key role in somitogenesis and is specifically required for sclerotome development. Required for maintenance of the sclerotome polarity and formation of the cranio-cervical joints (PubMed:19520072). Binds specifically to the promoter of target genes and regulates their expression. Activates expression of NKX3-2 in the sclerotome (PubMed:15024065). Activates expression of CDKN1A and CDKN2A in endothelial cells, acting as a regulator of vascular cell proliferation. While it activates CDKN1A in a DNA-dependent manner, it activates CDKN2A in a DNA-independent manner (PubMed:22206000). Required for hematopoietic stem cell (HSCs) induction via its role in somitogenesis: specification of HSCs occurs via the deployment of a specific endothelial precursor population, which arises within a sub-compartment of the somite named endotome (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
