Zfand2b (NM_001159905) Mouse Recombinant Protein
CAT#: TP503320
Purified recombinant protein of Mouse zinc finger, AN1 type domain 2B (Zfand2b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203320 protein sequence
Red=Cloning site Green=Tags(s) MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGE PPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQ TSRAGLAAISRAQGLASTSTAPSPSRTLPSSSSPSRATPQLPTRTASPVIALQNGLSEDEALQRALELSL AEAKPQVLSSQEEDDLALAQALSASEAEYQQQQAQSRSLKPSNCSLC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001153377 |
Locus ID | 68818 |
UniProt ID | Q91X58 |
Refseq Size | 1206 |
Cytogenetics | 1 C4 |
Refseq ORF | 771 |
Synonyms | 1110060O18Rik; C81256 |
Summary | Plays a role in protein homeostasis by regulating both the translocation and the ubiquitin-mediated proteasomal degradation of nascent proteins at the endoplasmic reticulum (PubMed:24160817, PubMed:26337389, PubMed:26692333). It is involved in the regulation of signal-mediated translocation of proteins into the endoplasmic reticulum (PubMed:24160817). It also plays a role in the ubiquitin-mediated proteasomal degradation of proteins for which signal-mediated translocation to the endoplasmic reticulum has failed (PubMed:18467495, PubMed:26337389). May therefore function in the endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation (PubMed:24160817, PubMed:26337389). By controlling the steady-state expression of the IGF1R receptor, indirectly regulates the insulin-like growth factor receptor signaling pathway (PubMed:26692333).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Zfand2b产品