Ctdsp1 (NM_153088) Mouse Recombinant Protein
CAT#: TP503403
Purified recombinant protein of Mouse CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (Ctdsp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203403 protein sequence
Red=Cloning site Green=Tags(s) MDSSAVITQISKEEARGPLRGKGDQKSAVSQKPRSRGILHSLFCCVCRDDGEPLPAHSGAPLLVEENGAI PKHTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQ RMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPA SYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 29.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_694728 |
Locus ID | 227292 |
UniProt ID | P58466 |
Refseq Size | 2790 |
Cytogenetics | 1 C3 |
Refseq ORF | 783 |
Synonyms | GIP; Nif3; NLIIF; SCP1 |
Summary | Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation (By similarity). Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |