Lasp1 (NM_010688) Mouse Recombinant Protein

CAT#: TP503460

Purified recombinant protein of Mouse LIM and SH3 protein 1 (Lasp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203460 protein sequence
Red=Cloning site Green=Tags(s)

MNPNCARCGKIVYPTEKVNCLDKYWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE
NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGVE
PERREAQDSSSYRRPTEQQQPQPHHIPTSAPVYQQPQQQQMTSSYGGYKEPAAPVSIQRSAPGGGGKRYR
AVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034818
Locus ID 16796
UniProt ID Q61792
Refseq Size 3433
Cytogenetics 11 61.1 cM
Refseq ORF 789
Synonyms AA408629; Def-4; SH3P6; Tg(Col1a1-lacZ)1Ngma
Summary Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...