Crybb1 (NM_023695) Mouse Recombinant Protein

CAT#: TP503610

Purified recombinant protein of Mouse crystallin, beta B1 (Crybb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203610 protein sequence
Red=Cloning site Green=Tags(s)

MSQAAKASATTAVNPGPDGKGKGAPSTGPAPAPGPTPVPASVPRPAAKVGDLPPGSYRLIVFEQENFQGR
RVEFSGECLNLGDRGFDRVRSLIVVSGPWVAFEQSAFRGEMFVLEKGEYPRWDTWTSSYRSDRLMSFRPI
RMDSQEHKICLFEGANFKGNTMEIQEDDVPSLWVYGFCDRVGSITVSGGTWVGYQYPGYRGYQYLLEPGD
FRHWNEWGAFQPQMQAVRRLRDRQWHQEGCFPVLTAEPPQVRQAPGLPSTARPASRPIFPY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_076184
Locus ID 12960
UniProt ID Q9WVJ5
Refseq Size 873
Cytogenetics 5 54.63 cM
Refseq ORF 813
Synonyms 3110006K12Rik; BB1CRY
Summary This gene encodes a member of the crystallin family of proteins that contribute to the transparency and refractive properties of the ocular lens. The encoded protein associates with other beta crystallin proteins to form dimers, tetramers and other higher-order complexes. This gene is located adjacent to a related crystallin gene on chromosome 5. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...