Pef1 (NM_026441) Mouse Recombinant Protein

CAT#: TP503692

Purified recombinant protein of Mouse penta-EF hand domain containing 1 (Pef1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203692 protein sequence
Red=Cloning site Green=Tags(s)

MASYPNGQSCPGAAGQVPGVPPGGYYPGPPHGGGQYGSGLPPGGGYGAPAPGGPYGYPSAGGVPSGTPSG
PYGGIPPGGPYGQLPPGGPYGTQPGHYGQGGVPPNVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWS
SFNDETCHMMINMFDKTKSGRIDVAGFSALWKFLQQWRNLFQQYDRDRSGSISSTELQQALSQMGYNLSP
QFTQLLVSRYCARSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080717
Locus ID 67898
UniProt ID Q8BFY6
Refseq Size 1551
Cytogenetics 4 D2.2
Refseq ORF 825
Synonyms 2600002E23Rik; Peflin
Summary Calcium-binding protein that acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium. Together with PDCD6, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in endoplasmic reticulum (ER)-Golgi transport by regulating the size of COPII coats. In response to cytosolic calcium increase, the heterodimer formed with PDCD6 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification. Its role in the heterodimer formed with PDCD6 is however unclear: some evidence shows that PEF1 and PDCD6 work together and promote association between PDCD6 and SEC31 in presence of calcium. Other reports show that PEF1 dissociates from PDCD6 in presence of calcium, and may act as a negative regulator of PDCD6 (By similarity). Also acts as a negative regulator of ER-Golgi transport; possibly by inhibiting interaction between PDCD6 and SEC31 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...