Smug1 (NM_027885) Mouse Recombinant Protein

CAT#: TP503761

Purified recombinant protein of Mouse single-strand selective monofunctional uracil DNA glycosylase (Smug1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203761 protein sequence
Red=Cloning site Green=Tags(s)

MAASQTFPLGPTHEPASALMEPLPCTRSLAEGFLEEELRLNAELSQLQFPEPVGVIYNPVDYAWEPHRNY
VTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGVGGPVLTPPQEHPKRPVLGLECPQSEVSG
ARFWGFFRTLCGQPQVFFRHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLSICDAALCRQVQLLGVR
LVVGVGRLAEQRARRALAGLTPEVQVEGLLHPSPRSAQANKGWEAAARERLQELGLLPLLTDEGSARPT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082161
Locus ID 71726
UniProt ID Q6P5C5
Refseq Size 3611
Cytogenetics 15 F3
Refseq ORF 837
Synonyms 1200013B09Rik; A930006H09Rik; C85220
Summary Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward mismatches (U/G) compared to matches (U/A). Excises uracil (U), 5-formyluracil (fU) and uracil derivatives bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU)] in ssDNA and dsDNA, but not analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. The activity is damage-specific and salt-dependent. The substrate preference is the following: ssDNA > dsDNA (G pair) = dsDNA (A pair) at low salt concentration, and dsDNA (G pair) > dsDNA (A pair) > ssDNA at high salt concentration.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...