Bcdin3d (NM_029236) Mouse Recombinant Protein

CAT#: TP503874

Purified recombinant protein of Mouse BCDIN3 domain containing (Bcdin3d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203874 protein sequence
Red=Cloning site Green=Tags(s)

MAADGTLSRGGVGEAVEEEHPGALEPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPPEGPEKRPIL
GLDVGCNSGDLSVALYKHFLSPRDGETCSGASRELRILCCDIDPVLVERAERDCPFPEALTFITLDIMDQ
ESRKVPLSSFLSQFGRSVFDMVFCMSVTMWIHLNHGDRGLCEFLAHVSSLCSYLLVEPQPWKCYRAAARR
LRKLGLHSFDHFRSLAIRGDMAKQIVRILTQDHGMELACCFGNTSWDRSLLLFRAKHTHETQAIPESSTK
ETRTD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083512
Locus ID 75284
UniProt ID Q91YP1
Refseq Size 1271
Cytogenetics 15 F1
Refseq ORF 855
Synonyms 4930556P03Rik; AV138748
Summary O-methyltransferase that specifically monomethylates 5'-monophosphate of cytoplasmic histidyl tRNA, acting as a capping enzyme. Less efficiently, also methylates the 5' monophosphate of pre-miRNAs, acting as a negative regulator of miRNA processing. The 5' monophosphate of pre-miRNAs is recognized by DICER1 and is required for pre-miRNAs processing: methylation at this position reduces the processing of pre-miRNAs by DICER1. Able to mediate methylation of pre-miR-145, as well as other pre-miRNAs. There is some controversy about the methylation of pre-miR-145, since the dimethylation first described as the specific enzymatic activity cannot be reproduced by a more recent work which observes a monomehtylation of pre-miR-145 but two orders weaker than the methylation of cytosolic histidyl tRNA.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...