Bcdin3d (NM_029236) Mouse Recombinant Protein
CAT#: TP503874
Purified recombinant protein of Mouse BCDIN3 domain containing (Bcdin3d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203874 protein sequence
Red=Cloning site Green=Tags(s) MAADGTLSRGGVGEAVEEEHPGALEPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPPEGPEKRPIL GLDVGCNSGDLSVALYKHFLSPRDGETCSGASRELRILCCDIDPVLVERAERDCPFPEALTFITLDIMDQ ESRKVPLSSFLSQFGRSVFDMVFCMSVTMWIHLNHGDRGLCEFLAHVSSLCSYLLVEPQPWKCYRAAARR LRKLGLHSFDHFRSLAIRGDMAKQIVRILTQDHGMELACCFGNTSWDRSLLLFRAKHTHETQAIPESSTK ETRTD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 32 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083512 |
Locus ID | 75284 |
UniProt ID | Q91YP1 |
Refseq Size | 1271 |
Cytogenetics | 15 F1 |
Refseq ORF | 855 |
Synonyms | 4930556P03Rik; AV138748 |
Summary | O-methyltransferase that specifically monomethylates 5'-monophosphate of cytoplasmic histidyl tRNA, acting as a capping enzyme. Less efficiently, also methylates the 5' monophosphate of pre-miRNAs, acting as a negative regulator of miRNA processing. The 5' monophosphate of pre-miRNAs is recognized by DICER1 and is required for pre-miRNAs processing: methylation at this position reduces the processing of pre-miRNAs by DICER1. Able to mediate methylation of pre-miR-145, as well as other pre-miRNAs. There is some controversy about the methylation of pre-miR-145, since the dimethylation first described as the specific enzymatic activity cannot be reproduced by a more recent work which observes a monomehtylation of pre-miR-145 but two orders weaker than the methylation of cytosolic histidyl tRNA.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Bcdin3d产品