Pih1d1 (NM_029406) Mouse Recombinant Protein

CAT#: TP503954

Purified recombinant protein of Mouse PIH1 domain containing 1 (Pih1d1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203954 protein sequence
Red=Cloning site Green=Tags(s)

MADSTFLAPELSDTESMGEETVRFQELLLKASKELQQAQTARPDSTQIQPKPGFCVKTNSSEGKVFINIC
HSPSIPPPADVTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRE
LVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNIRSQQRPRIQELGTLDASGSLGTCHGPERPHL
NLWLEAPDLLLAEVDLPKLDGAQGLALEIGENRLVIGGPQQLYHLDATVPLRINSEASRAAFHRRRKQLM
VSMPLLTAPS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083682
Locus ID 68845
UniProt ID Q9CQJ2
Refseq Size 1196
Cytogenetics 7 B3
Refseq ORF 870
Synonyms 1110061L23Rik; 4933413A04Rik; Nop17
Summary Involved in the assembly of C/D box small nucleolar ribonucleoprotein (snoRNP) particles. Recruits the SWI/SNF complex to the core promoter of rRNA genes and enhances pre-rRNA transcription. Mediates interaction of TELO2 with the R2TP complex which is necessary for the stability of MTOR and SMG1. Positively regulates the assembly and activity of the mTORC1 complex.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...