Hnrnpc (NM_001170984) Mouse Recombinant Protein

CAT#: TP504015

Purified recombinant protein of Mouse heterogeneous nuclear ribonucleoprotein C (Hnrnpc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Hnrnpc Antibody - C-terminal region
    • 50 ug

CNY 4628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204015 protein sequence
Red=Cloning site Green=Tags(s)

MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGRSVHKGFAFVQYVNERNARAAVAGE
DGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAV
VPSKRQRVSGNTSRRGKSGFNSKSGQRGSSSKSGKLKGDDLQAIKKELTQIKQKVDSLLESLEKIEKEQS
KQAEMKNEKSEEEQSSASVKKDETNVKMESEAGADDSAEEGDLLDDDDNEDRGDDQLELKDDEKEPEEGE
DDRDSANGEDDS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001164455
Locus ID 15381
UniProt ID Q9Z204
Refseq Size 2781
Cytogenetics 14 26.79 cM
Refseq ORF 876
Synonyms AL022939; D14Wsu171e; hnrnp-C; hnRNPC1; hnRNPC2; Hnrpc; Hnrpc1; Hnrpc2
Summary Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. Interacts with poly-U tracts in the 3' UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules. Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides. May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch', facilitating binding of HNRNPC, leading to regulation of mRNA splicing.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...