Rps6kb2 (BC066842) Mouse Recombinant Protein

CAT#: TP504038

Purified recombinant protein of Mouse ribosomal protein S6 kinase, polypeptide 2 (cDNA clone MGC:76640 IMAGE:30468251), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204038 protein sequence
Red=Cloning site Green=Tags(s)

MAAVFDLDLETEEGSEGEGEPEFSPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPERNGPHCFELL
SVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQT
GGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKL
TDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSASPASLGAGWVLGR
SLPGWGRTGWEDP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 58988
UniProt ID Q9Z1M4
Refseq Size 2105
Cytogenetics 19 A
Refseq ORF 879
Synonyms S6K2, 70kDa
Summary Phosphorylates specifically ribosomal protein S6. Seems to act downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression in an alternative pathway regulated by MEAK7.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...