Usf1 (BC049784) Mouse Recombinant Protein
CAT#: TP504108
Purified recombinant protein of Mouse upstream transcription factor 1 (cDNA clone MGC:59374 IMAGE:6506829), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204108 representing BC049784
Red=Cloning site Green=Tags(s) MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ LDGQTEGSGAISGYPATQSMTQAVIQGAFTSDDAVDTEGAAAETHYTYFPSTAVGDGSGGTTSGSTTAVV TTQGSEALLGQATPPSTGQFFVMMSPQEVLQGGCQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ QVRLTPGWPPWQPRSH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 70.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 22278 |
UniProt ID | Q61069 |
Refseq Size | 1926 |
Cytogenetics | 1 79.4 cM |
Refseq ORF | 888 |
Synonyms | bHLHb11 |
Summary | This protein encoded by this gene is a member of the basic-Helix-Hoop-Helix-Leucine zipper (bHLH-LZ) family and encodes a protein that can act as a transcription factor. Studies indicate that the basic region interacts with DNA at E-Box motifs, while the helix-loop-helix and leucine zipper domains are involved in dimerization with different partners. This protein is involved in a wide array of biological pathways, including cell cycle regulation, immune response, and responses to ultraviolet radiation. Mice lacking most of the coding exons of this gene often lacked both whiskers and nasal fur, and were prone to epileptic seizures, while mice lacking both this gene and another family member, Usf2, displayed embryonic lethality (PMID:9520440). Mutations in the human ortholog of this gene have been associated with Familial Combined Hyperlipidemia (FCHL) in humans. Pseudogenes of this gene are found on chromosome 11 and the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2015] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...