Wdfy1 (BC025226) Mouse Recombinant Protein
CAT#: TP504332
Purified recombinant protein of Mouse WD repeat and FYVE domain containing 1 (cDNA clone MGC:32262 IMAGE:5011404), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR204332 protein sequence
Red=Cloning site Green=Tags(s) MNFIKTYPAHQNRVSAIIFSLSAEWVISTGHDKCVSWMCTRSGNMLGRHFFSSWASCLQYDLDTQHAFVG DYSGQITLLKLEQNTCSVITTLKGHEGSIACLWWDPIQRLLFSGASDNSVIMWDIGGRKGRTLLLQGHHD RVQSLCYLQLTRQLVSCSADGGIAVWNMDVSREEAPQWLESDSCQKCEQPFFWNIKQMWDTKTLGLRQHH CRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDSIKDEDRTSLATFHEGKHNISHMSMDIARGLMVT CGTDRVVKIWDMTPVVGCSLATGFSPH myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 34.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 69368 |
| UniProt ID | E9Q4P1 |
| Refseq Size | 1363 |
| Cytogenetics | 1 C4 |
| Refseq ORF | 921 |
| Synonyms | 1700120F24Rik, WDF1, FENS-1, Jr1, ZFYVE17 |
| Summary | Positively regulates TLR3- and TLR4-mediated signaling pathways by bridging the interaction between TLR3 or TLR4 and TICAM1. Promotes TLR3/4 ligand-induced activation of transcription factors IRF3 and NF-kappa-B, as well as the production of IFN-beta and inflammatory cytokines (PubMed:25736436).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
