Tomm34 (NM_025996) Mouse Recombinant Protein
CAT#: TP504376
Purified recombinant protein of Mouse translocase of outer mitochondrial membrane 34 (Tomm34), transcript variant Tom34b, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR204376 protein sequence
Red=Cloning site Green=Tags(s) MAPKVSDSVEQLRAAGNQNFRNGQYGEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDC IKDCTSALALVPFSIKPLLRRASAYEALEKYALAYVDYKTVLQIDNSVASALEGINRITRALMDSLGPEW RLKLPPIPVVPVSAQKRWNSLPSDNHKETAKTKSKEATATKSRVPSAGDVERAKALKEEGNDLVKKGNHK KAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSS LSDISSLLQIEPRNGPAQKLRQEVNQNMN myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 34.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_080272 |
| Locus ID | 67145 |
| UniProt ID | Q9CYG7 |
| Refseq Size | 2319 |
| Cytogenetics | 2 H3 |
| Refseq ORF | 927 |
| Synonyms | 2610100K07Rik; TOM34 |
| Summary | Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
