Rdh11 (NM_021557) Mouse Recombinant Protein

CAT#: TP504536

Purified recombinant protein of Mouse retinol dehydrogenase 11 (Rdh11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204536 protein sequence
Red=Cloning site Green=Tags(s)

MFGFLLLLSLPFILYLVTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACR
DVDKGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFE
MHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNLQGEKFYSAGLAYCHSKLANILFT
KELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSH
FSDCQLAWVSYQGRNEIIARRLWDVSCDLLGLPVDW

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067532
Locus ID 17252
UniProt ID Q9QYF1
Refseq Size 1574
Cytogenetics 12 35.51 cM
Refseq ORF 948
Synonyms 2610319N22Rik; AI428145; Arsdr1; AU045252; C85936; CGI-82; HCBP12; M42C60; Mdt1; Psdr1; SCALD
Summary Retinol dehydrogenase with a clear preference for NADP (PubMed:12807874, PubMed:29567832). Displays high activity towards 9-cis, 11-cis and all-trans-retinol, and to a lesser extent on 13-cis-retinol (By similarity) (PubMed:12807874). Exhibits also reductive activity towards toxic lipid peroxidation products such as medium-chain aldehydes trans-2-nonenal, nonanal, and cis-6-nonenal (PubMed:12807874). Has no dehydrogenase activity towards steroid (PubMed:12807874). Seems to be required for homeostasis of retinol in liver and testis (PubMed:29567832).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...