Dhdds (NM_026144) Mouse Recombinant Protein

CAT#: TP504923

Purified recombinant protein of Mouse dehydrodolichyl diphosphate synthase (Dhdds), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204923 protein sequence
Red=Cloning site Green=Tags(s)

MSWIKEGELSLWERFCANIIKAGPVPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGI
LEVTVYAFSIENFKRSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQ
ATKNYNKCFLNVCFAYTSRHEIANAVREMAWGVEQGLLEPSDVSESLLDKCLYSNHSPHPDILIRTSGEV
RLSDFLLWQTSHSCLVFQPVLWPEYTFWNLCEAILQFQRNHGALQKARDMYAEERKRRQLERDQAAVTEQ
LLREGLQASGDAQLRRTRLHKLSTKREERVQGFLKALELKRANWLALWGTASA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080420
Locus ID 67422
UniProt ID Q99KU1
Refseq Size 3110
Cytogenetics 4 D3
Refseq ORF 999
Synonyms 3222401G21Rik; CIT; DS; HDS; W91638
Summary With NUS1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Both subunits contribute to enzymatic activity, i.e. condensation of multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol phosphate which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...