Map2k6 (NM_011943) Mouse Recombinant Protein
CAT#: TP504942
Purified recombinant protein of Mouse mitogen-activated protein kinase kinase 6 (Map2k6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204942 protein sequence
Red=Cloning site Green=Tags(s) MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKM RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAK TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA DKFSADFVDFTSQCLKKNSKERPTYPELMQHPFFTVHESKAADVASFVKLILGD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 37.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036073 |
Locus ID | 26399 |
UniProt ID | P70236 |
Refseq Size | 2064 |
Cytogenetics | 11 E1- E2 |
Refseq ORF | 1002 |
Synonyms | MEK6; MKK6; Prkmk6; SAPKK3 |
Summary | Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...