Taf7 (NM_175770) Mouse Recombinant Protein
CAT#: TP505109
Purified recombinant protein of Mouse TATA-box binding protein associated factor 7 (Taf7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205109 representing NM_175770
Red=Cloning site Green=Tags(s) MSKNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDRVPLAAKLVDL PCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEAAATADPKANKKKDKDKEKKFVWNHGITLPL KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKETENQGLDISSPGMSGHRQG HDSLEHDELREIFNDLSSSSEDEEDVNILDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNM KGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 39.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_786964 |
| Locus ID | 24074 |
| UniProt ID | Q9R1C0 |
| Refseq Size | 3302 |
| Cytogenetics | 18 B3 |
| Refseq ORF | 1023 |
| Synonyms | 55kDa; AI607308; BB007175; Taf2f; TAFII55 |
| Summary | Functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
