Rrm2b (NM_199476) Mouse Recombinant Protein
CAT#: TP505344
Purified recombinant protein of Mouse ribonucleotide reductase M2 B (TP53 inducible) (Rrm2b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205344 protein sequence
Red=Cloning site Green=Tags(s) MGDPERPEAARPEKGEQLCSETEENVVRSNEEPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVD LSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKK RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCV LMKQYIEFVADRLLGELGFSKIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD F myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 40.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_955770 |
| Locus ID | 382985 |
| UniProt ID | Q6PEE3 |
| Refseq Size | 4532 |
| Cytogenetics | 15 B3.1 |
| Refseq ORF | 1053 |
| Synonyms | p53R2 |
| Summary | Plays a pivotal role in cell survival by repairing damaged DNA in a p53/TP53-dependent manner. Supplies deoxyribonucleotides for DNA repair in cells arrested at G1 or G2. Contains an iron-tyrosyl free radical center required for catalysis. Forms an active ribonucleotide reductase (RNR) complex with RRM1 which is expressed both in resting and proliferating cells in response to DNA damage.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
