Gga2 (BC057377) Mouse Recombinant Protein
CAT#: TP505395
Purified recombinant protein of Mouse golgi associated, gamma adaptin ear containing, ARF binding protein 2 (cDNA clone MGC:67474 IMAGE:5698559),, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205395 protein sequence
Red=Cloning site Green=Tags(s) MLSMYRRPGHALPDQQALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQANDLLTQGVRLYKQVVEGR VSAGNAVPAAVGAIPAPRAFPNPEPCGLNCPLIDLETPSLLHQDLAALGINDVPTRNQVVIPSCCNDKKQ PGAITLMGGGIQSLSADRNLLDLFSPQPSPGLNYVPQKSIPKEVPPGTKASPGWSWEAGPLASSTASQNT PLAHVFVPLESVKPSSLPPIVVYDRNGFRILLHFSQTGAPGHPDVKVLLLTMMSTATQPVWDVMFQVAVP KSMRVKLQPASSSKLPAFSPLMPPAVISQTLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAV LSTA myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 38.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 74105 |
| UniProt ID | Q6P5E6 |
| Refseq Size | 2370 |
| Cytogenetics | 7 F2 |
| Refseq ORF | 1062 |
| Synonyms | 1200007E24Rik; mKIAA1080 |
| Summary | Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (DXXLL) motif. Mediates export of the GPCR receptor ADRA2B to the cell surface. Regulates retrograde transport of phosphorylated form of BACE1 from endosomes to the trans-Golgi network.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
