Ascc1 (NM_026937) Mouse Recombinant Protein
CAT#: TP505422
Purified recombinant protein of Mouse activating signal cointegrator 1 complex subunit 1 (Ascc1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205422 protein sequence
Red=Cloning site Green=Tags(s) MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEPCGAYEVAQTPHGFRATVSAPSLLYK HIVGKRGDTKKKIEVETKTSINIPKHGHEGEIVITGQHRNGVVSARTRIDVLLDTFRRRQPFTHFLSFFL NEVEVQERFLMFQEEVLRKCSKDRGVDSTIFQNPKKLHLTIGMLVLLSEQEIQQTCEILQRCKEEFINDI SGGRPLEVEMAGIEYMNDDPAMVDVLYAKVHMKDGSNRLQELVDRVLERFQSLGLIVKEWTSVKLHATVM NTLLRKDPNAEGRYNLYTADGKYIFKERESFDGRNILKTFENFYFGSLRLNSIHISQRFTVDSFGNYASC GHVDFS myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 41.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_081213 |
| Locus ID | 69090 |
| UniProt ID | Q9D8Z1 |
| Refseq Size | 1505 |
| Cytogenetics | 10 B4 |
| Refseq ORF | 1068 |
| Synonyms | 1810015P09Rik; AI550520; ASC1p50; CGI-18 |
| Summary | Plays a role in DNA damage repair as component of the ASCC complex. Part of the ASC-1 complex that enhances NF-kappa-B, SRF and AP1 transactivation. In cells responding to gastrin-activated paracrine signals, it is involved in the induction of SERPINB2 expression by gastrin. May also play a role in the development of neuromuscular junction.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
