Plod1 (BC010268) Mouse Recombinant Protein
CAT#: TP505599
Purified recombinant protein of Mouse procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 (cDNA clone MGC:8124 IMAGE:3589182), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205599 protein sequence
Red=Cloning site Green=Tags(s) MGADLCRQDQTCTYYFSVDADVALTEPNSLRLLIEQNKNVIAPLMTRHGRLWSNFWGGLSADGYYARSED YVDIVQGRRVGVWNVPYISNIYLIKGSALRAELQNVDLFHYSKLDSDMSFCANVRQQEVFMFLTNRHTFG HLLSLDNYQTTHLHNDLWEVFSNPEDWKEKYIHENYTKALAGKLVETPCPDVYWFPIFTEAACDELVEEM EHYGQWSLGDNKDNRIQGGYENVPTIDIHMNQITFEREWHKFLVEYIAPMTEKLYPGYYTRAQFDLAFVV RYKPDEQPSLMPHHDASTFTVNIALNRVGEDYEGGGCRFLRYNCSVRAPRKGWALLHPGRLTHYHEGLPT TKGTRYIAVSFVDP myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 42.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 18822 |
| UniProt ID | Q9R0E2 |
| Refseq Size | 1903 |
| Cytogenetics | 4 78.57 cM |
| Refseq ORF | 1092 |
| Synonyms | Plod, LH1 |
| Summary | Part of a complex composed of PLOD1, P3H3 and P3H4 that catalyzes hydroxylation of lysine residues in collagen alpha chains and is required for normal assembly and cross-linkling of collagen fibrils (PubMed:27119146). Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens (By similarity). These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links (PubMed:27119146).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
