Agpat5 (NM_026792) Mouse Recombinant Protein
CAT#: TP505612
Purified recombinant protein of Mouse 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) (Agpat5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205612 protein sequence
Red=Cloning site Green=Tags(s) MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPARLYQRVDDRLYCVYQNMVLFFFENYT GVQILLYGDLPKNKENVIYLANHQSTVDWIVADMLAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIY VKRSAKFNDKEMRSKLQSYVNAGTPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKA THVAFDSMKSHLDAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKK WLHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTESGRKLYMGTW LYGTLLGCLWFVIKA myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 42.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_081068 |
| Locus ID | 52123 |
| UniProt ID | Q9D1E8 |
| Refseq Size | 3829 |
| Cytogenetics | 8 10.3 cM |
| Refseq ORF | 1095 |
| Synonyms | 1110013A05Rik; D8Ertd319e |
| Summary | Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone (PubMed:15367102). Acts on LPA containing saturated or unsaturated fatty acids C15:0-C20:4 at the sn-1 position using C18:1-CoA as the acyl donor (By similarity). Also acts on lysophosphatidylethanolamine using oleoyl-CoA, but not arachidonoyl-CoA, and lysophosphatidylinositol using arachidonoyl-CoA, but not oleoyl-CoA (By similarity). Activity toward lysophosphatidylglycerol not detectable (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
