Sh2d2a (NM_001025571) Mouse Recombinant Protein

CAT#: TP505637

Purified recombinant protein of Mouse SH2 domain containing 2A (Sh2d2a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205637 protein sequence
Red=Cloning site Green=Tags(s)

MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSMQVMKEQGVQLSPRTNHTVVSASAPG
TAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQAHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLV
RFSESAVTFVLSYRSQTCCRHFLLAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQ
TAEPAGLSLRADSDSGSKRQDPDTQLSLLLQQGQAQASGHTEKTSQASRPRPPIPAKPQLPPEVYTSPAS
RLHQAPPINPIYQEPDEPIAFYAMGRGSPGDAPSNIYAEVEGPSGTAPIGHPILRKCWSRPISRGQVREV
QGKISSRSRAERGSPS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001020742
Locus ID 27371
UniProt ID Q5D0E4
Refseq Size 4734
Cytogenetics 3 38.78 cM
Refseq ORF 1098
Synonyms Lad; Ribp; Tsad
Summary Could be a T-cell-specific adapter protein involved in the control of T-cell activation. May play a role in p56-LCK-mediated T-cell signaling. Could be involved in the regulation of responses to T-cell activation stimuli, specifically proliferation and lymphokine production. Interactions with ITK and TXK may provide important biochemical links of these two important kinases with other components in the T-cell activation machinery.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...