Rad9a (NM_011237) Mouse Recombinant Protein

CAT#: TP506078

Purified recombinant protein of Mouse RAD9 checkpoint clamp component A (Rad9a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206078 protein sequence
Red=Cloning site Green=Tags(s)

MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQYQAASPGQDL
LRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKKTHNLSFQDCESLQAVFDPAS
CPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRSYQEEEADSTSKAMVTETSIGDEDFQQLHAP
EGIAVTFCLKEFRGLLSFAESANLPLTIHFDVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKP
HQPVPQKQAHSTPHLDDFTSDDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTV
PGTPPPKKFRSLFFGSILAPVHSPQGPNPVLAEDSDGEG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035367
Locus ID 19367
UniProt ID Q9Z0F6
Refseq Size 2046
Cytogenetics 19 A
Refseq ORF 1167
Synonyms Rad9
Summary Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase. RAD9A possesses 3'->5' double stranded DNA exonuclease activity (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...