Serpina10 (BC018416) Mouse Recombinant Protein
CAT#: TP506155
Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 (cDNA clone, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR206155 protein sequence
Red=Cloning site Green=Tags(s) MRVASSLFLPVLLTEVWLVTSFNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEE YWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQA GPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLIN HCIVKETEGKIPKLFDEINPETKLILVDYVLFKGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKT RKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSG TLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 45.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 217847 |
| UniProt ID | Q8R121 |
| Refseq Size | 1450 |
| Cytogenetics | 12 E |
| Refseq ORF | 1182 |
| Synonyms | MGC25863, ZPI, PZI |
| Summary | The protein encoded by this gene is a member of the large serpin family of proteins, and is also known as serpin PZ-dependent protease inhibitor (ZPI or PZI). This protein is thought to play an important role in the regulation of coagulation. It directly inhibits factor XIa, and also inhibits factor Xa in the presence of calcium, phospholipids, and protein Z (PZ). Deficiencies in this gene lead to an increase in thrombosis. Alternative splicing results in multiple transcript variants that encode multiple protein isoforms. [provided by RefSeq, Aug 2014] |
Documents
| FAQs |
| SDS |
其它Serpina10产品
